SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000006324 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000006324
Domain Number 1 Region: 79-219
Classification Level Classification E-value
Superfamily TNF-like 4.26e-40
Family TNF-like 0.000000094
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000006324
Domain Number - Region: 13-72
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0471
Family beta-sandwich domain of Sec23/24 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000006324   Gene: ENSDNOG00000008162   Transcript: ENSDNOT00000008166
Sequence length 222
Comment pep:known_by_projection scaffold:Dasnov3.0:JH573163.1:223086:232540:1 gene:ENSDNOG00000008162 transcript:ENSDNOT00000008166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IESCVSGKKAGPPGPNGPPGPPGPPGPQGPPGIPGIPGIPGTTVMGPPGPPGPPGPQGPP
GLQGPSGAADKAGTRENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPR
SGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTA
GVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPAS
Download sequence
Identical sequences ENSDNOP00000006324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]