SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000006485 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000006485
Domain Number 1 Region: 430-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.21e-18
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 2 Region: 139-182
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000235
Family KRAB domain (Kruppel-associated box) 0.0036
Further Details:      
 
Domain Number 3 Region: 309-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000056
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number 4 Region: 368-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000299
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000006485
Domain Number - Region: 44-116
Classification Level Classification E-value
Superfamily Tropomyosin 0.0012
Family Tropomyosin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000006485   Gene: ENSDNOG00000008381   Transcript: ENSDNOT00000008371
Sequence length 497
Comment pep:known_by_projection scaffold:Dasnov3.0:JH583620.1:4572228:4578713:1 gene:ENSDNOG00000008381 transcript:ENSDNOT00000008371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RARSIPCKHKRKRRSTPLTSSTLLPQATERSSYLQTTEISLWTVVAAIQAVEKKMESQAA
RLQNLEGRAGTAEKKLADCEKMAVEFGNQLEGKWTVLGTLLQEYGLLQRRLENMENLLRN
RNFWVLRLPPGSNGEDPNVSRSFENDGVCFSEQEWENLEDWQKELYRNVMKSNYETLVSL
KVLGQPEGEAELGTEMLDDLEEEGPGGGHPADGVMIKPEMQYQPEGSEDLSGEFSGIAEE
EAFLSPEQAEFWNGQGSSVLLESGPGDTNLEEPIEGSRDPSSGRTLGCHLKQKSNRQVQL
DQECGQGLKLKGNTSSPYRCSECKISFHYKQQLAMHLRTHSGWESYTASEPEENLRPRPR
LKPQPKKAKLHQCDVCMRSFSCKISLVTHQRCHLQEGPAAGQHIQERFSPNSLVALPGHI
PWRKSRSSLICGYCGKSFSHPSDLVRHQRIHTGERPYSCTECEKSFVQKQHLLQHQKIHQ
RERGGLALESGRPKGLL
Download sequence
Identical sequences ENSDNOP00000006485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]