SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000006491 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000006491
Domain Number 1 Region: 918-1094
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.59e-37
Family BCR-homology GTPase activation domain (BH-domain) 0.00042
Further Details:      
 
Domain Number 2 Region: 490-606
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.01e-32
Family Pyk2-associated protein beta ARF-GAP domain 0.0017
Further Details:      
 
Domain Number 3 Region: 284-380
Classification Level Classification E-value
Superfamily PH domain-like 7.12e-23
Family Pleckstrin-homology domain (PH domain) 0.00046
Further Details:      
 
Domain Number 4 Region: 1177-1324
Classification Level Classification E-value
Superfamily PH domain-like 9.18e-17
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 
Domain Number 5 Region: 8-64
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000903
Family SAM (sterile alpha motif) domain 0.0047
Further Details:      
 
Domain Number 6 Region: 391-498
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000462
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 7 Region: 604-786
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000247
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 
Domain Number 8 Region: 801-909
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000448
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 9 Region: 1134-1196
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000232
Family Ras-binding domain, RBD 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000006491   Gene: ENSDNOG00000008355   Transcript: ENSDNOT00000008377
Sequence length 1547
Comment pep:known_by_projection scaffold:Dasnov3.0:JH564669.1:693638:718827:-1 gene:ENSDNOG00000008355 transcript:ENSDNOT00000008377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPQDLDIAVWLATIHLEQYADTFRRYGLATAGAAQGLGHEELRELGIGATGHRKRILR
LLQAGAAERPQDPHSDSAMEPSPSPAPQPQPPKPVPKPRTVFGGLSGPATTQRPGLSPAP
WQAEVSRSPESSPRSSPQPTSSAEQSSALNSVELMPNAIYFGLDSRGGSQAAQETAPDNS
QAAAPTPSLRPTTGTVHIMDPGCLYYGVQSAGAAGPPDRRESRGVCQDRTEHRLSRQDLE
AREDASYASLELPGDSAFALPILDMEETSDDLISPYASFSSMADRPSPLLSAWLDKLSPQ
GNYVFQRRFVQFNGRSLMYFGSDKDPFPKGVIPLTAIEMARSSKDNKFQVITGQRVFVFR
TESEAQRDTWCSTLQSCLKEQRLLGHPRPPQPPRPLRTGMLELRGHKAKVFAALSPGELA
LYKSEQAFSLGIGICFIDLQGCSVRETKSRSFDLLTPHRCFSFTAESGGARQSWAAALQE
AVTETLSDYEVAEKIWSNRANRHCADCGASRPDWAAVNLGVVICKQCAGQHRALGSGISK
VQSLKLDTSVWSNEIVQLFIVLGNDRANRFWAGALPPGEGLHPDTTPGPRGEFISRKYRL
GLFRKPHPQFPDHSQFLQALCTAVAGPNLLKTMTQLLCVEASEGEEEPWSPSAFDGNFPG
LLPADPSPGVYNEVVVPATYSSFLYCGPISNKAGLPPPRKGRDAPHRLWCVLGAALEMFA
SESSPEPLSLIQPQDVVCLGVSPPPTDPSDLDRFPFSFELILTGGRIQHFGTEGADSLEA
WTSALGKWFSPLSCHQLLGPGLLRLGRLWLRSPSHTALASGLWLSGFGLLRGDHLFLCPA
PGPGPPAPEDMVHLRRLQEISVVSAADTPDKKEHLVLVETGRTLYLQGEGRLDFSAWNTA
IGGAAGGGGTGLQEQQMSRGDIPIIVDACISFVTQHGLRLEGVYRKGGARARSLRLLAEF
RRDARSVKLRPGEHFVEDVTDTLKRFFRELDDPVTSARLLPRWREAAELPQKNQRLEKYK
EVIGCLPRVNRRTLATLIGHLYRVQKCAALNQMCTRNLALLFAPSVFQTDGRGEHEVRVL
QELIDGYVSVFDIDSDQVAQIDLEVSLITTWKDVQLSQAGDLIMEVYIEQQLPDNCVTLK
VSPTLTAEELTNQVLEMRGTAPGTDLWVTFEIREHGELERPLHPKERVLEQALQWCQLPE
PCSASLLLQKVSLAKAGCLFTGIRRESPRMGLLRCREEPPRLLGSRFQERFFLLRDRCLL
LLKEKRSCKPEREWPLEGAKVYLGIRKKLKPPTPWGFTLILEKMHLYLSCTDEDEMWDWT
TSILKAQHDDQQPVILRRRSSSDLARQKFGTMPLLPIRGDDSGATLLSANQTLRRLHNRR
TLSMFFPMKSSQGSVEEQEELEEPVYEEPVYEEVGAFPELTKDTATSFSTTWEWTAKPET
SPTSQRSFDQALLSKTGTLGGEERLFEPPLGPTSKSSPQARGSLEEQLLQELSSLILRKG
ETTDGLSSSSQPSSPQAPSPTGLPTQTSDFPTHHPCTSSPPSSQPLT
Download sequence
Identical sequences ENSDNOP00000006491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]