SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000006819 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000006819
Domain Number 1 Region: 354-558
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-44
Family BCR-homology GTPase activation domain (BH-domain) 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000006819   Gene: ENSDNOG00000008802   Transcript: ENSDNOT00000008807
Sequence length 710
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569653.1:664922:807303:-1 gene:ENSDNOG00000008802 transcript:ENSDNOT00000008807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLRGSKDVLCFSLKNIVTETLDPARRESISRCRRVNRMLSNESIHSPAFSRSNSQASID
SASMEDFWRETESVKEDSIGGQEEAKPLDEGELEAEWLQDVGLSTLISGGEEEAGKALLS
TLTRTQAAAVKKRYNTYSQTMRKKNKQSARDVRDIFGVSESSPGDTGDNHTAQLDGTREE
QELPPVIRTSGPMPDDASLSITCLSDESQDEEGRFAVPRGSSVSILETLPDLPIHSNGAP
DPGPKPAQNAVRGDFLEKNIAPEAEELSFEVSYSEMVTEAPKRNTFKRSDIKKEDCALTK
FIVQKTRFGLTEAGDLSVEDMRKVRHLSLIELTAFFDAFGIQLKRNKTEKVKGRDSGIFG
VPLTVLLDIDRKKDPGLKVPLVLQKFFEKVEESGLESEGIFRLSGCTAKVKQYREELDAK
FNADKFKWDKMCHREAAVMLKAFFRELPTSLFPVEYIPAFISLMERGPHIKVQFQALHLM
IMALPDANRDTAQALLTFFNKVIANESKNRMSMWNISTVMAPNLFFSRSKHSDYEELLLA
NTAAHIIRLMLKYQKILWKVPSFLITQVRRMNEASMLLKKQLPSVKKLLRRKTIERETVS
PKASKTLQKTHSSRRMSDVPEGVIRVHAPLLSKVSMAIQLNSQTKAKDILAKFQYENSHG
SSECIKVQNQRLYEIGGNIGQHCLDPDAYILDVYHVNPQAEWVIKPQPSF
Download sequence
Identical sequences ENSDNOP00000006819 XP_004467018.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]