SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000006904 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000006904
Domain Number 1 Region: 505-656
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.11e-67
Family Ankyrin repeat 0.000000045
Further Details:      
 
Domain Number 2 Region: 1-217,268-293
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.08e-60
Family BAR domain 0.0017
Further Details:      
 
Domain Number 3 Region: 385-501
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.44e-34
Family Pyk2-associated protein beta ARF-GAP domain 0.00000191
Further Details:      
 
Domain Number 4 Region: 266-373
Classification Level Classification E-value
Superfamily PH domain-like 1.81e-21
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 
Domain Number 5 Region: 1005-1083
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-16
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000006904   Gene: ENSDNOG00000008886   Transcript: ENSDNOT00000008903
Sequence length 1085
Comment pep:known_by_projection scaffold:Dasnov3.0:JH567436.1:1614414:1832727:1 gene:ENSDNOG00000008886 transcript:ENSDNOT00000008903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKSVKAINISGLAHVENEEQYTQALEKFGGNCVCRDDPDLGSAFLKFSVFTKELTALFK
NLIQNMNNIISFPLDSLLKGDLKGVKGDLKKPFDKAWKDYETKITKIEKEKKEHAKLHGM
IRTEISGAEIAEEMEKERRFFQLQMCEYLLKVNEIKIKKGVDLLQNLIKYFHAQCNFFQD
GLKAVESLKPSIETLSSDLHTIKQAQDEERRQLIQLRDILKSALQVEQKEEDLIVKMIIL
PKLMYRFDDSQIRQSTAYSLHQPQGNKEHGTERNGNLYKKSDGIRKVWQKRKCSVKNGFL
TISHGTANRPPAKLNLLTCQVKTNPEEKKCFDLISHDRTYHFQAEDEQECQIWMSVLQNS
KEEALNNAFKGDDSTGENNIVQELTKEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILT
CIECSGIHRELGVHYSRMQSLTLDVLGTSELLILKANLVFRKLPECCLPAEDSVKPNPSS
DMNARKDYITAKYIERKYARKKHMDNAAKLHSLCEAVKTRDIFGLLQAYADGVDLTEKIP
LANGHEPDETALHLAVRSVDRTSLHIVDFLVQNSGNLDKQTGKGSTALHYCCLTDNAECL
KLLLRGKASIEIANESGETPLDIARRLKHEHCEELLTQALSGRFNSHVHVEYEWRLLHED
LDESDDDMDEKLQPSPSRREDRPVSFYQLGSNQLQSNAASLARDAASLAKDKQRGFVPSI
LQNETYGALLSSSPPPTQPAAPSTTSAPPLPPRNVGKGTKLLAALSPLTKPPFAFFISPL
PALPSKVYSQSACISYLYAPHKIKDKKEHLWFGKFQTASSANTLWKTNSVSVDAVSRQRS
SSDPPAVHPPLPPLRVTSTINFSLSTDPLTPTPPPPVAKTPSVVEALGQQTKPAQPGIPQ
GKPTPPPLPPQPPSRLPQKKPAPGLTDSHNPFMKQISHLCLHLLFSAAKSGPPPDFVQPA
SQVVTPVSRLSCFNSVAILPSAEPLILLLSWSPTLLSPSADGDLNLAMQPPAPMPRKSQI
TKLKPKRVKALYNCVADNPDELTFSEGDVIIVDGEEDQEWWIGHIDGDPSRKGAFPVSFV
HFIAD
Download sequence
Identical sequences ENSDNOP00000006904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]