SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000007291 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000007291
Domain Number 1 Region: 1285-1427
Classification Level Classification E-value
Superfamily PH domain-like 4.81e-54
Family Phosphotyrosine-binding domain (PTB) 0.00000388
Further Details:      
 
Domain Number 2 Region: 186-314
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.18e-37
Family PLC-like (P variant) 0.0019
Further Details:      
 
Domain Number 3 Region: 18-183
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.54e-30
Family Dual specificity phosphatase-like 0.00018
Further Details:      
 
Domain Number 4 Region: 1145-1276
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-23
Family SH2 domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000007291   Gene: ENSDNOG00000031410   Transcript: ENSDNOT00000009412
Sequence length 1432
Comment pep:known_by_projection scaffold:Dasnov3.0:JH568166.1:298259:454656:-1 gene:ENSDNOG00000031410 transcript:ENSDNOT00000009412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLSARPAAPLSAAMEDGYELDLTYITERIIAVSFPAGCSEESYLHGLQKVTRMLKSEKTN
NFKVLNLSEKRYDLTKLNPKIMDVGWPDQHAPPLDKMCSVCKAQESWLHSDPQHVVVIHC
RGGKGRIGVVISSYMHFTNVSASADQALDRFAMKKFYDDKVSALMQPSQKRYVQFLSGLL
SGSVKMNASPLFLHFVILHGIPSFDTGGACRPFLKLYQAMQPVYTSGIYHVGLENQSRVC
IAIEPAQLLKGDVMVKCYHKKYRSATRDVIFRLQFHTGAVQGYGLMFGKEDLDDASKDDR
FPDYGKIELVFSATPEKIQGSDHLRSDRGVTVDYNTADPLIRWDSYENLGADGEVLHTQG
PVDGSLYAKVRKKSASDSGILGGPQPALATSCPDHGDHTLSVSSDSGHSTTSVRTDRTEE
RLPVGARRGLSPQEKAELDQLLSGFGLEGSGGPLQEMTAAPGQASGTRHVVPAQVHVNGD
AKPKERETDILDDEVPPHDLHSVDSIGTLSSSEGQPSATLGACPGRESSQHSLLSDAGEE
QPGAADPPHERALGSRRPPAPLLRKPPVSAETQAYGQSACLTQTWVRQQQMVAAHQYGFA
LDGEARPGGPVTAPSRIPVTPTRGASSRVAVQRGTGGTPDGPEPQQPPLRGRAFQPRLPE
DAVTNGVNPELDASLAPGSPTLDIDQSIEQLNRLILELDPTFEPIPTHLSPPGGQANGAA
SPDRVAGGLRGSGRPRDAGEAAGRGPRRQGPIGEGPLGGRLRKLSLGQYDNDAGGKMSFS
RCILENLTHADQAPQLSPFLIAADTKETVTTGYPPGIDVIDGRIFSPTKTSHEPISPTPA
FPVSPETPYESPPPRIPAVPCGQQPTAGVPLFSPGPEPQGCSEIRSHSTGMSEYPAGPKS
AMLRADTPAFPQAFTSSCTISSSSPAPRRDSGPSSAGHHWLETSPTSALVMLGSSRPAGS
LLSTSEFPGPAQAPPALPHLPPELQGALSGREHTLAEPPGAPGTPGAPAFLSLGGPGVGS
GLLPGPDPGALLAGSHGASPLTAAGPADNGFLPHGFLPGVAGLGVQLSPGLQGPGAALPG
QPPLPEKKRASEGDRSFGSISPSSSGFSSPHSGSTISIPFPSVLPDFSKASERASPLPDN
PGDKHVTVKFVQDTSKFWYKPDISREQAIAMLKDKEPGSYIIRDSHSFRGAYGLAMKVAT
PPPSVLQLNKKAGDLANELVRHFLIECTPKGVRLKGCPNEPYFGSLTALVYQHSITPLAL
PCRLLIPDRDPLEEVAETSPQTAANSAAELLKQGAACNVWYLNSVEMESLTGHQAVQKAL
TITLGQEPPPISTVVHFKVSAQGITLTDNQRKLFFRRHYPVNSVIFCALDPQDRKKWLGD
LSSCRVFGFVARKQGSATDNVCHLFAEHDPEQPASAIVNFVSKVMIGSARKV
Download sequence
Identical sequences ENSDNOP00000007291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]