SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000007372 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000007372
Domain Number 1 Region: 209-374,780-959
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 4.32e-125
Family Mammalian PLC 0.0000061
Further Details:      
 
Domain Number 2 Region: 532-645
Classification Level Classification E-value
Superfamily SH2 domain 5.12e-31
Family SH2 domain 0.00000165
Further Details:      
 
Domain Number 3 Region: 433-550
Classification Level Classification E-value
Superfamily SH2 domain 3.9e-27
Family SH2 domain 0.00042
Further Details:      
 
Domain Number 4 Region: 977-1099
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.27e-25
Family PLC-like (P variant) 0.0023
Further Details:      
 
Domain Number 5 Region: 678-739
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-19
Family SH3-domain 0.000028
Further Details:      
 
Domain Number 6 Region: 42-200
Classification Level Classification E-value
Superfamily EF-hand 0.000000387
Family Calmodulin-like 0.046
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000007372
Domain Number - Region: 372-413
Classification Level Classification E-value
Superfamily PH domain-like 0.000337
Family Pleckstrin-homology domain (PH domain) 0.00038
Further Details:      
 
Domain Number - Region: 4-29
Classification Level Classification E-value
Superfamily PH domain-like 0.00728
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000007372   Gene: ENSDNOG00000009471   Transcript: ENSDNOT00000009508
Sequence length 1179
Comment pep:known_by_projection scaffold:Dasnov3.0:JH562036.1:287072:321597:1 gene:ENSDNOG00000009471 transcript:ENSDNOT00000009508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFRLKTLSLQATSEEEVNMWIKGLTWLMEDTWQAATPLQIERWLRKQFYSVDRNREDRI
SAKDLKNMLSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMYSAQKTMDLPF
LEASALRAGERPELCRVSLPEFQQFLLEYQGELWAVDRLQVQEFMLSFLRDPLREIEEPY
FFLEEFVTFLFSKENSVWNSQLDAVNPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEA
YARCLRMGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILS
IEDHCSIAQQRNMAQHFRKVLGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAY
EEVPTSVMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSAQGNEDE
EEPKEASGSTELHSNEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFV
GDYTLSFWRNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMR
LSEPVPQTNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKI
KHCRVQQEGQMVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYG
ALYEGRNPGFYVEANPMPTFKCAVKALFDYKAQRDDELTFTKSAIIQNVEKQEGGWWRGD
YGGKKQLWFPSNYVEEMVNPAALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNS
RLFVFSISMASVAHWSLDVAADSQEELQDWVKKIREVTQTADARLTEGKMMERRKKIALE
LSELVVYCRPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIY
PKGQRLDSSNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFLAGGHCGYVLQPSTMRDE
GFDPFDKSSLRGLESCTICIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDNTKQKTEFVV
DNGLNPVWPAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPL
KNNYSEDLELASLLIKIDLFPAKQENGDISPFGGTSLRERGSDASGQLFHGRAREGSFEA
RYQQPFEDLRSSQEHLADHFDGRDRRAPRRTRVNGDNRL
Download sequence
Identical sequences ENSDNOP00000007372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]