SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000007476 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000007476
Domain Number 1 Region: 153-227
Classification Level Classification E-value
Superfamily SH3-domain 4.46e-18
Family SH3-domain 0.00013
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000007476
Domain Number - Region: 118-160
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0418
Family beta-sandwich domain of Sec23/24 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000007476   Gene: ENSDNOG00000009645   Transcript: ENSDNOT00000009649
Sequence length 251
Comment pep:known_by_projection scaffold:Dasnov3.0:JH566134.1:184473:222713:1 gene:ENSDNOG00000009645 transcript:ENSDNOT00000009649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGK
GFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGFEPDRRDSQDSSSYRRPQ
EQLPPQPHHIPASTPVYQQPQQQPAAQSYGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSA
ADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGNLPRHYLESILSARRHISLPSTAS
RGPEVAPGRPQ
Download sequence
Identical sequences ENSDNOP00000007476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]