SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000007483 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000007483
Domain Number 1 Region: 1-266
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.23e-44
Family FCH domain 0.01
Further Details:      
 
Domain Number 2 Region: 556-640
Classification Level Classification E-value
Superfamily SH3-domain 1.01e-21
Family SH3-domain 0.00057
Further Details:      
 
Domain Number 3 Region: 449-524
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000042
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000007483   Gene: ENSDNOG00000009658   Transcript: ENSDNOT00000009663
Sequence length 728
Comment pep:known_by_projection scaffold:Dasnov3.0:JH579338.1:619940:976944:-1 gene:ENSDNOG00000009658 transcript:ENSDNOT00000009663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTFSQKKAAIERDYAQGIQKLASQYLKRDWPGVKADDRNDYRSMYPVWKSFLEGTMEFE
QNCSYFCFKYFFFLSAPQKTHFKIQSQKILQCVDQLTKIQTELQETVKDLAKGKKKYFET
EQMAHAIREKADIEAKSKLSLFQSRISLQKASVKLKARRSECNSKATHARNDYLLTLAAA
NAHQDRYYQTDLVNIMKALDGNVYDHLKDYLIAFSRTELETCQAMQNTFQFLLETSNKVV
RDYNLQLFLQENAVFHKPQPFQFQPCDSDTSLKAAQLVDIELSPVSALRMTIAESRQLES
ETGTTEEHSLNKEARKWATRVAREHKNIVHQQRVLDELECHGVAVSEQSRAELEQKIDEA
KENIRKAEIIKLKAEARLDLLKQIGVSVDTWLKSAMNQVMEELENERCARLPAVTNNGTL
HSLNTDTEREEGEEFEDNMDVFDDSSKNNPNSSLGHVPILYCRSMFVYKASQPDELTIEE
HEVLEVIEDGDMEDWVKARNKVGQVGYVPEKYLQFPTSNSLLSMLQSLAALDSRSHTSSN
STEAELVSGSLNGDASVCFVKALYDYEGQTDDELSFPEGAIIRILNKENQDDDGFWEGEF
NGRIGVFPSVLVEELSASENGDTSWIREIQISPSPKPHGSLPPLPLYDQPPSSPYPSPDK
RSSQYFPRSPSANENSLHSESPGFSQASRHTLETSYGKLRPVRAAPPPPTQNHRRPAEKI
EDVEITLV
Download sequence
Identical sequences ENSDNOP00000007483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]