SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000007597 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000007597
Domain Number 1 Region: 127-235
Classification Level Classification E-value
Superfamily E2F-DP heterodimerization region 3.66e-31
Family E2F dimerization segment 0.0018
Further Details:      
 
Domain Number 2 Region: 48-112
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.5e-17
Family Cell cycle transcription factor e2f-dp 0.0000427
Further Details:      
 
Domain Number 3 Region: 10-41
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000549
Family beta-sandwich domain of Sec23/24 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000007597   Gene: ENSDNOG00000009802   Transcript: ENSDNOT00000009805
Sequence length 349
Comment pep:known_by_projection scaffold:Dasnov3.0:JH573670.1:12547752:12588374:-1 gene:ENSDNOG00000009802 transcript:ENSDNOT00000009805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAEPASSGQQAPQGQGQGQRPQPQPPQPQPPQPPQQFGGGGGGSSRHEKSLGLLTTKF
VSLLQEAKDGVLDLKAAADTLAVRQKRRIYDITNVLEGIDLIEKKSKNSIQWKGVGAGCN
TKEVIDRLRYLKAEIEDLEMKERELDQQKLWLQQSIKNVMDDSINNRYPFNTFSYVTHED
ICNCFNGDTLLAIQAPSGTQLEVPIPEMGQNGQKKYQINLKSHSGPIHVLLINKESSSSK
PVVFPVPPPDDLTQPSSQPSTPVTPQKPNLATQNLPEPPASERSETLQHTPATDISSAGS
ISGDIIDELMSSDVFPLLRLSPTPADDYNFNLDDNEGVCDLFDVQILNY
Download sequence
Identical sequences ENSDNOP00000007597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]