SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000007912 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000007912
Domain Number 1 Region: 90-193
Classification Level Classification E-value
Superfamily SH2 domain 5.39e-32
Family SH2 domain 0.0000533
Further Details:      
 
Domain Number 2 Region: 22-133
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000236
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000007912   Gene: ENSDNOG00000037792   Transcript: ENSDNOT00000010217
Sequence length 221
Comment pep:known_by_projection scaffold:Dasnov3.0:JH568154.1:5265:32236:-1 gene:ENSDNOG00000037792 transcript:ENSDNOT00000010217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGSLPSRGKTRPSPSPSVHDQGPAPRPAEGRKATAVALGTFPGGERAELSLRLGEPLAV
VSEHGDWWTVLSEISGREFSIPSAHVARISHGWLYEGLSREKAEELLLLPGNPGGAFLIR
ESQSRRGCYSLSVRLSRPSSWDQIRHYRIHRLDNGWLYISPRLTFPSLQALVDHYSELAD
DICCLLKEPCALLRARPFPGKAVPLPVTVQTTPLNWKELDR
Download sequence
Identical sequences ENSDNOP00000007912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]