SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000009125 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000009125
Domain Number 1 Region: 779-982
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.79e-48
Family DBL homology domain (DH-domain) 0.00013
Further Details:      
 
Domain Number 2 Region: 1016-1213
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.2e-44
Family BAR domain 0.0024
Further Details:      
 
Domain Number 3 Region: 242-307
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-18
Family SH3-domain 0.00085
Further Details:      
 
Domain Number 4 Region: 1517-1574
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-16
Family SH3-domain 0.000031
Further Details:      
 
Domain Number 5 Region: 143-205
Classification Level Classification E-value
Superfamily SH3-domain 6.3e-16
Family SH3-domain 0.00088
Further Details:      
 
Domain Number 6 Region: 4-62
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000879
Family SH3-domain 0.0017
Further Details:      
 
Domain Number 7 Region: 1281-1358
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000223
Family SH3-domain 0.00000734
Further Details:      
 
Domain Number 8 Region: 69-134
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000236
Family SH3-domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000009125   Gene: ENSDNOG00000011766   Transcript: ENSDNOT00000011769
Sequence length 1580
Comment pep:known_by_projection scaffold:Dasnov3.0:JH568182.1:824480:952996:1 gene:ENSDNOG00000011766 transcript:ENSDNOT00000011769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGSVVRAIFDFCPSVSEELPLFVGDIIEVLAVVDEFWLLGKKEDVTGQFPSSFVEIVT
IPSLKEGEKLFVCICEFVSQELNSLPLHRGDLVILDGAPTDGWLQGRSCWGARGFFPSSC
VRELCLSSQSRQWHSQSALLQIPEYSMGQARALMGLSAQLEEELDFREGDVITIIGVPEP
GWFEGELDGRRGIFPEGFVELLGPLRSVEKSVSSGSQDGCIINGVGATPLGEEERTPEED
AGQPGTYGIALYRFQALEPNELDFEEGDKIQILGTLEDGWLEGSLKGRTGIFPYRFVKLC
PNTRVEDTTDLPQESCQTKVPESSLDCLENSLVVEEKRHESHESRAEMSNCVTSETSPSP
LDHLTSEYEVNKNACEDGGLLGGPPRSPGMEQEKSLAKDSSMNDTLEVANGISSQPKGPF
HPKWKENQYCSTAGAGHQSSEKYSHLLPFEARTRDYSIPPSKGAYSQLKTVQKPVPPPHR
FLISDSRGAKLSQLNSQLQGMSRNAKKHHRSKEQVSHFSTVSERSETQPGSHGKGLAMEA
AALSQGDDSTDLDTKLTQQLMEFEKSLSGPDTESDKISRHFSIMDFSSEKDIVQGSLKLI
TQQELPERRKALRPPPPRPCTPTSTSPHLLIDPNLKPAPPLAMRPSRPAPLPPSAQQRMD
AVSSRLLTGNRPSCETLEKEGSENTEKTLNRTSPCPLVLVRIQEMEQDLDMYRRTQEELN
LILEEKQDESVRAEVLENLELYESNIESLNMELQQLREMTILSSQSSSLAAPSLSVSTEN
PEQRMLEKRAKVVEELLQTERDYVRDLEMCIEWIMVPLQQAQVPNIDFEGLFGNMQMVIK
VSKQLLAALEISDAVGPVFLDHRDELEGTYKVYCQNHDEAISLLEIYEKDEKIQKHLQES
LANLKSLYKEWGCTNYINLGSFLIKPVQRVMRYPLLLMELLNSTPESHPDKMPLTNAVLA
VKEINVNINEYKRRKDLVLKYRKGDEDSLMEKISKLNIHSIIKKSSRVSSHLKHLTGFAP
QIKDEAFEETEKNFRMQERLIKSFIRDLSLYLQHIRESACVKVVAAVSMWDVCVEKGNRE
LEQFEKVHRYITDQLFTNFKERTERLVISPLTQLLSMFTGPHKLVQKRFDKLLDFYNCTE
RAEKLKDKKTLEELQSARNNYEALNAQLLDELPKFQQYAQGLFSNCIHGYAEAHCDFVQQ
ALEQLKPLLSLLKVAGREGNLIAIFHEEHSRVLQQLQVFTFFPESLPAAKKPFERKTMER
QSTRKPLLGLPSYMLQSEELRASLLARYPPEKLFQAERNVNAAQDLDVSLLEGDLVGVIK
KKDPMGSQNRWLIDNGVTKGFVYSSFLKPYNPRRSHSDVSVGSHSSTESEHSSSSPRVLR
QNSNSTLTFNPSGMAVSFTPGPCQKHPQDASPLKEFDQGNLSASLTLGHSESSPTRCLSD
TDSTFQPRPRDPVDAARDITQPATTPRSHRCSRHPEMVGYSLPGQNGQDKDPIKGCARTT
QSLEGKNEEPESREAEGNQVYFAVYTFKARNPNELSVSANQRLRILEFKDVTGNTEWWLA
EVNGKKGYVPSNYICKTEYT
Download sequence
Identical sequences ENSDNOP00000009125 XP_004459253.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]