SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000009451 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000009451
Domain Number 1 Region: 871-1144
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.64e-68
Family Protein kinases, catalytic subunit 0.00000797
Further Details:      
 
Domain Number 2 Region: 610-853
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.73e-44
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 3 Region: 419-543
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000000011
Family SH2 domain 0.002
Further Details:      
 
Domain Number 4 Region: 147-278
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000345
Family Second domain of FERM 0.0043
Further Details:      
 
Domain Number 5 Region: 363-423
Classification Level Classification E-value
Superfamily PH domain-like 0.00000059
Family Third domain of FERM 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000009451   Gene: ENSDNOG00000012151   Transcript: ENSDNOT00000012175
Sequence length 1158
Comment pep:known_by_projection scaffold:Dasnov3.0:JH582969.1:1248031:1300568:-1 gene:ENSDNOG00000012151 transcript:ENSDNOT00000012175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQYLNIKEDCNAMAFCAKMRSSKKTEVTLEAPEPGVAVLFYLPDREPIQLGNGEYTAEEL
CIKAAQECHISPLCHNLFALYDENTRLWYAPNHTITVDDKTLLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGDQSLFRMKSPWGQPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKKYLATLETLTKHYGAEIFLFLCPLLLLSAAREV
WLHTGQGGLGCHYHIVFILLRKWRLKEQAVPVEKEKNKLKRKKLENKHKKDEEKNKIREE
WNNFSYFPEITHIVIKESVVNINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAHHY
LCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVTCF
EKSEVLGSQKQFKNFQIEVQKGRYSLHGSGDSFPSLGDLMGHLKKQILRTDNISFVLKRC
CQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDIVQGKWKGRPGMHTHMHTYTH
IDYKDDEGTSEEKRIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDVE
NIMVEEFVEGGPLDLFMHRKSDALTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLL
AREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSRKLSVAADKWSFGTT
LWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIM
RDINKLEEQNPDIVSERKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTG
EQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSG
SLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDF
GLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSDS
SPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTTF
QNLIEGFEALLKISMNNI
Download sequence
Identical sequences ENSDNOP00000009451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]