SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000009492 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000009492
Domain Number 1 Region: 356-541
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.57e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000912
Further Details:      
 
Domain Number 2 Region: 5-48,86-211
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.46e-34
Family FCH domain 0.01
Further Details:      
 
Domain Number 3 Region: 593-648
Classification Level Classification E-value
Superfamily SH3-domain 3.81e-16
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000009492   Gene: ENSDNOG00000012217   Transcript: ENSDNOT00000012224
Sequence length 933
Comment pep:known_by_projection scaffold:Dasnov3.0:JH570311.1:34269:113653:1 gene:ENSDNOG00000012217 transcript:ENSDNOT00000012224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLQSKEVGQQLQDDLMKVLNELYSVMKTYHMYNADSISAQSKLKEAEKQEEKQIGKSVK
QEDRQTPRSPDSSSNVRIEEKHVRRSSVKKIEKMKEKRQAKYTENKLKAIKARNEYLLAL
EATNASVFKYYIHDLSDLIDQCCDLGYHASLNRALRTFLSAELNLEQSKHEGLDAIENAV
ENLDATSDKQRLMEMYNNVFCPPMKFEFQPHMGDMASQLCAQQPVQSELVQRCQQLQSRL
STLKIENEEVKKTMEATLQTIQDIVTVEDFDVSDCFQYSNSMESVKSTVSETFMSKPSIA
KRRANQQETEQFYFTKMKEYLEGNLITKLQAKHDLLQKTLGESQRTDCSLARRSSTVRKQ
DSSQAIPLVVESCIRFISRHGLQHEGIFRVSGSQVEVNDIKNAFERGEDPLAGDQNDHDM
DSIAGVLKLYFRGLEHPLFPKDIFHDLIACVTMDNLQERALHIRKVLLVLPKTTLIIMRY
LFAFLNHLSQFSEENMMDPYNLAICFGPSLMSVPEGHDQVSCQAHVNELIKTIIIQHENI
FPNPRELEGPVYSRGGSMEDYCDSPHGETTSAEDSTQDVTTEHHTSDDECEPIEAIAKFD
YVGRTARELSFKKGASLLLYQRASDDWWEGRHNGIDGLIPHQYIVVQDTEDGVVERSSPK
SEIEVISEPPEEKVTARAGASCPSGGHVADIYLANINKQRKRPESGSIRKTFRSDGHGLS
SSLTDSSSLGVGAGCRPSSQPILSQSLPKEGPDKCSISGHGSLNSISRHSSLKNRLDSPQ
IRKTVTAGRSKSFNNHRPVDPEVIAQDIEATMNSALNELRELERQSSVKHTPDVVLDTLE
PLKTSPVVAPTSEPSSPLHTQLLKDPEPAFQRSASTAGDIACAFRPVKSVKMAAPVKPPA
TRPKPTVFPKTNATSPSVNSSASPPSTDKSCTV
Download sequence
Identical sequences ENSDNOP00000009492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]