SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000009599 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000009599
Domain Number 1 Region: 285-464
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.24e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.00000226
Further Details:      
 
Domain Number 2 Region: 2-186
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.54e-40
Family BAR domain 0.0074
Further Details:      
 
Domain Number 3 Region: 160-261
Classification Level Classification E-value
Superfamily PH domain-like 2.72e-16
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000009599   Gene: ENSDNOG00000012350   Transcript: ENSDNOT00000012369
Sequence length 696
Comment pep:known_by_projection scaffold:Dasnov3.0:JH581871.1:278984:582416:1 gene:ENSDNOG00000012350 transcript:ENSDNOT00000012369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHNASDLLIKPLENFRKEQIGFTKERKKKFEKDGERFYSLLDRHLHLSSKKKESQLQEA
DLQVDKERHSFFESSLDYVYQIQEVQESKKFNIVEPVLAFLHSLFISNSLTVELTQDFLP
YKQQLQLSLQNTRNHFSSTREEMEELKRRMKEAPQTCKLPGQPTIEGYLYTQEKWALGIS
WVKYYCQYEKETKTLTMTPMEQKPGAKQGPLDLTLKYCVRRKTESIDKRFCFDIETNERP
GTITLQALSEANRRLWMEAMDGKEPIYHSPITKQEEMELNEVGFRFVRKCINVIESKGIK
TEGLYRTVGSNIQVQKLLTAFFDPKCPGDVDFHNSDWDIKTITSSLKFYLRNLSEPVMTY
RLHKELISAAKSDNLDYRLGAIHSLVYKLPEKNREMLELLIRHLVNVCEHSKENLMSPSN
MGVIFGPTLMRAQEDTVAAMMNIKFQNIVVEILIEHSGKIYSGPPEESTAPPVPPPRVTA
RRHKPITISKRLLRERTVFYTSSLDESEDEIQHQIPNGTITSSIEPPKLPQHPKLPIQRS
GEVDPGRKSPSRPLSDGKLEHCSDVDVGKLVSRLQDGGTKSTSKATNGPVLGPGSTKVPS
FNIKRPTARLLAHHTEGDSDSFSKVRPPGEKPTIIRPPMRPPDPPCRGTTPQKPDLVAGN
SEEIPSSVVASRTRFFETASRKTGSSSQGRLPRDDS
Download sequence
Identical sequences ENSDNOP00000009599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]