SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000010558 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000010558
Domain Number 1 Region: 9-171,198-322
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.35e-63
Family FCH domain 0.0022
Further Details:      
 
Domain Number 2 Region: 485-679
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.14e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.0000666
Further Details:      
 
Domain Number 3 Region: 732-787
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000276
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000010558   Gene: ENSDNOG00000013610   Transcript: ENSDNOT00000013619
Sequence length 1070
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569307.1:360152:514733:1 gene:ENSDNOG00000013610 transcript:ENSDNOT00000013619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLFSLEIRAQLVEQQKCLEQQTEMRVQLLQDLQDFFRKKAEIETEYSRNLEKLAERFM
AKTRSTKDHQQYKKDQNLLSPVNCWYLLLNQVRRESKDHATLSDIYLNNVIMRFMQISED
STRMFKKSKEIAFQLHEDLMKVLNELYTVMKTYHMYHAESISAESKLKEAEKQEEKQIGR
SGDPVFHIRLEEKHQRRSSVKKIEKMKEKRQAKYSENKLKSIKARNEYLLTLEATNASVF
KYYIHDLSDLIDCCDLGYHASLNRALRTYLSAEYNLETSRHEGLDIIENAVDNLEPRSDK
QRFMEMYPAAFCPPMKFEFQSHMGDEVCQVSAQQPVQAEFMLRYQQLQSRLATLKIENEE
VKKTSEATLQTIQDMVTIEDYDVSECFQHSRSTESVKSTVSETYLSKPSIAKRRANQQET
EQFYFMKLREYLEGSNLITKLQAKHDLLQRTLGEGHRSEYMTTRPPSIPPKPQKHKKSRP
RSQYNAKLFNGDLETFVKDSGQIIPLIVESCVRFINLYGLQHQGIFRVSGSQVEVNDIKN
SFERGENPLADDQSNHDINSVAGVLKLYFRGLENPLFPKERFNDLISCIRIDNLYERALH
IRKLLLTLPRSVLIVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPVPEIQDQVSC
QAHVNEIVKTIIIHHETIFPDAKELDGPVYEKCMAGDDYCDSPYSEHGTLEEVDQDAGTE
THTSEDECEPIEAIAKFDYVGRSARELTFKKGASLLLYHRASEDWWEGRHNGIDGLVPHQ
YIVVQDMDDTFSDTLSQKADSEASSGPVTEDKSSSKDMNSPTDRHSDGYLARQRKRGEPT
PPVRRPGRTSDGHCPLHPPHALSNSSIDLGSPSLASHPRGLLQNRGLNNDSPERRRRPGH
GSLTNISRHDSLKKIDSPPIRRSTSSGQYTGFNDHKPLDPETIAQDIEETMNTALNELRE
LERQSTAKHAPDVVLDTLEQVKNSPTPATSTESLSPLHNVALRSSEPQIRRSTSSSSDTM
STFKPMVAPRMGIQLKPPALRPKPAVLPKTNPTIGPTPPSQGPADKSCTM
Download sequence
Identical sequences ENSDNOP00000010558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]