SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000010985 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000010985
Domain Number 1 Region: 19-97
Classification Level Classification E-value
Superfamily HR1 repeat 3.92e-18
Family HR1 repeat 0.0036
Further Details:      
 
Domain Number 2 Region: 504-594
Classification Level Classification E-value
Superfamily PDZ domain-like 1.48e-16
Family PDZ domain 0.0000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000010985   Gene: ENSDNOG00000014140   Transcript: ENSDNOT00000014144
Sequence length 689
Comment pep:known_by_projection scaffold:Dasnov3.0:JH574065.1:1950412:2003845:-1 gene:ENSDNOG00000014140 transcript:ENSDNOT00000014144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDALLPAGPQALEKKGNSYFRKGCNPLAQTGRSKLQNQRAALNQQILKAVRMRTGAENL
LKAATNQRVREQARLELSFVNSDLQMLKEELEGLNISVGVYQSTEEAFPIPLIPLGLKET
KDVDFSVVLKDFILEHYSEDSYLYEDEIADLTDLRQACRTPSRDQAGVELLMSYFIQLGF
VENRFFPPTRQMGLLFTWYDSFTGVPVSQWNLLLEKASVLFNIGAIYTQIGTRCHRQAQA
GLKSAVDAFQRAAGVLNYLKETFTHTPSYDMSPAMLSVLVKMMLAQAQESVFEKISLPGI
QNEFFMLVKVSQEAAKVGEVYRQLHAAMSQAPVKENVPYSWAGLASVKAHHYGALAHYFA
ATLLIDHQWSMKLKVGAVQAGSSVAGLEVRDRVESGLDPLVPLRTWRRREAGKSHLRKAI
AHHEEAVREASLCKKLRSLEVLQEVLSAAHQRARVKYSQHQEDDDFLDLIEAPDVVSKTE
QEAEIIPPQFSKVTVTDFFQKLGPLSVFSANKRWTPPRSIHFITEEGDMGFTLRGNAPVQ
VHFLDPYCSAALAGAKEGDYIVSIQGVDCKWLTVSEVMKLLKSFGEDDIEMKVVSLLDST
SSMHNKCATYSVGMQKTYSMICLAMGDDEKTDKTKKISKKLSFLSWGTNKNRQKSASTLC
LPSVGVGRPPVKKKLPSPFSLLNSDSSLY
Download sequence
Identical sequences ENSDNOP00000010985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]