SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000011906 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000011906
Domain Number 1 Region: 92-149
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000066
Family RING finger domain, C3HC4 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000011906   Gene: ENSDNOG00000015365   Transcript: ENSDNOT00000015360
Sequence length 285
Comment pep:known_by_projection scaffold:Dasnov3.0:JH568085.1:340243:341100:-1 gene:ENSDNOG00000015365 transcript:ENSDNOT00000015360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APDTCCHQAPGKRERSLEMSSAGADSNPVRAAPAQSPCGRPAPESSDPLAPVPRMACIMS
PEGPALQRPQPVPAEATATNAKDPAGCPRGSLEGDLECLVCREPYTCARLPKLLGCQHTF
CAVCLKLLLCVHNDIWSISCPLCRKVTAVPGGLICSLRDQEAVVGRLVRPGLEVQLCPQG
LVDPAASATGHLGLAGEDGQDWASVNRVAARRLAAHLLLLVSLIFLILPFVYPGVIRWVL
GLIVGLALLMSALFCCHPSSPGSCWHSSQTLFCREQKPNQVSSIA
Download sequence
Identical sequences ENSDNOP00000011906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]