SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000012475 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000012475
Domain Number 1 Region: 9-161
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.05e-29
Family Hormone receptor domain 0.00000275
Further Details:      
 
Domain Number 2 Region: 133-450
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000156
Family Rhodopsin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000012475   Gene: ENSDNOG00000016083   Transcript: ENSDNOT00000016084
Sequence length 496
Comment pep:known_by_projection scaffold:Dasnov3.0:JH568921.1:1912785:1969089:-1 gene:ENSDNOG00000016083 transcript:ENSDNOT00000016084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLAQACLAALLLLPMATAMHSDCIFKKEQAMCLEKIQRANDLMGLNDSSPGCPGMWDN
ITCWKPARVGEMVLVSCPELFRIFNPDQVWETETIGELGFADSSSLGLSDMGVVSRNCTE
DGWSEPFPHYFDACGFDDNVSESGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRK
LHCTRNFIHMNLFVSFMLRAISVFIKDWILYAEQDNNHCFTSTVECKAIMVFFHYCVVSN
YFWLFIEGLYLFTLLVETFFPERRYFYWYIIIGWGTPTVCVTVWAVLRLYFDDTGCWDMN
DNTALWWVIKGPVVGSIMINFVLFIGIIVILVQKLQSPDMGGNESSIYFSCVQKCYCKPQ
RAQQHSCKMSELSTITLRLARSTLLLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQ
GFVVAVLYCFLNGEVQAEIKRKWRSWKVNRYFAVDFKHRHPSLASSGVNGGTQLSILSKS
SSQLRMSGLPADNLAT
Download sequence
Identical sequences XP_004463363.1.11602 ENSDNOP00000012475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]