SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000012547 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000012547
Domain Number 1 Region: 224-355
Classification Level Classification E-value
Superfamily PX domain 3.79e-27
Family PX domain 0.0021
Further Details:      
 
Domain Number 2 Region: 1-65
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000144
Family SH3-domain 0.0014
Further Details:      
 
Domain Number 3 Region: 381-584
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000698
Family IMD domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000012547   Gene: ENSDNOG00000016176   Transcript: ENSDNOT00000016180
Sequence length 587
Comment pep:novel scaffold:Dasnov3.0:JH566969.1:117711:200822:1 gene:ENSDNOG00000016176 transcript:ENSDNOT00000016180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYDFAAEPGNDELTVNEGEIITITNPDVGGGWLEGRNSKGERGLVPTDYVEILPSDGKDQ
FSCGNSVADQAFLDSLSASAAQTNSAAASSSNQVSGGSDPWSAWSASKSGNWESADGWGA
KPEGAAAQRNTANHWDSAFSHPQAYQGPAAGDDDDWDEDWDDPKTPSPYFKDPESAEASG
VQRGGSRASASSMKLPLNKFPGFAKPGVEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTS
TFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIP
SLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVVSESELFQQFLNFRDEKEWKTGKRK
AEKDELVGLMIFSTMEPEAPDLDLTEIEQKCDAVGKFTKAMDDGVKELLTVGQEHWKRCT
GALPKEYQKIGKALQSLASVFSSSGYQGETDLNDAITEAGKTYEEIANLVAEQPKKDLHF
LMECNHEYKGFLGCFPDIIGAHKGAIEKVKESDKLVATSKITAQDKQTMVKRVGTMSYAL
QAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALGRFPVM
Download sequence
Identical sequences XP_004456424.1.11602 ENSDNOP00000012547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]