SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000012731 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000012731
Domain Number 1 Region: 87-242
Classification Level Classification E-value
Superfamily TNF-like 1.04e-28
Family TNF-like 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000012731   Gene: ENSDNOG00000016414   Transcript: ENSDNOT00000016414
Sequence length 243
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569934.1:85397:87075:1 gene:ENSDNOG00000016414 transcript:ENSDNOT00000016414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGALGLEARGGRPQGRGCLLLAVAAATALGTLVLAVPTTVLAVLALAPQEQRGQVPETAD
PGAQSQPRLGSQEPPEEEEEVETDGPGLPAAHLIGAWTKGQGLGWEARNEEAFLRSGARF
SGPEGLALPRAGLYYLYCHVGYRGRAAPAGARRPALTLRSALYRAGGAYGPGAPELLLEG
AETVAPAAGRPGAHEPGPLWYTSVGFGGLVQLRGGERVFVNVSTPDLVDYRRGKTFFGAV
MVG
Download sequence
Identical sequences 9361.ENSDNOP00000012731 ENSDNOP00000012731 ENSDNOP00000012731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]