SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000012956 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000012956
Domain Number 1 Region: 232-305
Classification Level Classification E-value
Superfamily Homeodomain-like 2.61e-26
Family Homeodomain 0.00072
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000012956
Domain Number - Region: 56-66
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00968
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 30-84
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0837
Family beta-sandwich domain of Sec23/24 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000012956   Gene: ENSDNOG00000016724   Transcript: ENSDNOT00000016723
Sequence length 348
Comment pep:known_by_projection scaffold:Dasnov3.0:JH568374.1:140253:142213:-1 gene:ENSDNOG00000016724 transcript:ENSDNOT00000016723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAFPPSLMMMQRPLGSSTAFSIDSLIGSPPQPSPGHFVYTGYPMFMPYRPVVLPPPPP
PPPALPQAALQPALPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSASPQHQE
AAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAEAVQASLVGAVRG
QGKDESKVEDDPKGKEESFSLESDLDYSSDDNLTGQAAHKEEDPSHALEEPPPSGAAAGS
TTSTGKNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRA
KWKRVKAGNANSKTGEPSRNPKIVVPIPVHVSRFAIRSQHQQLEQARP
Download sequence
Identical sequences ENSDNOP00000012956 XP_004460804.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]