SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000013111 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000013111
Domain Number 1 Region: 125-158,242-295
Classification Level Classification E-value
Superfamily SET domain 0.000000262
Family Histone lysine methyltransferases 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000013111   Gene: ENSDNOG00000016926   Transcript: ENSDNOT00000016925
Sequence length 299
Comment pep:known_by_projection scaffold:Dasnov3.0:JH568145.1:358401:365639:1 gene:ENSDNOG00000016926 transcript:ENSDNOT00000016925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGRLLRGLWQRWHRYKYRFVPWIALNLSHNPRTLRYVPEESKDKVISDEDVQGTLLKVF
QALFLNDFNKQSDTLTMLPEPIKSKYQDLLAVQHQRVKLLKYRHRQQNIFTPEEVLYNTL
GFSVALATSSLISAGKGVFVTNGLVPKGSVVSMYPGTVYQKYEPIFFQSIGNSFIFRCLD
GVLIDGNDKGISKVVYRSCNGRDQLGPLKMSDSTWLTSEIHNPLAIGQYVNNCSNDRTAN
VCYQEFDVPEVFPVELKQYLPNIAYSSEKQSPLRCVVLVALRDIKQGEELFSNYYTIVS
Download sequence
Identical sequences XP_004458873.1.11602 ENSDNOP00000013111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]