SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000013237 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000013237
Domain Number 1 Region: 6-90
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-18
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000013237   Gene: ENSDNOG00000017080   Transcript: ENSDNOT00000017080
Sequence length 546
Comment pep:known_by_projection scaffold:Dasnov3.0:JH573438.1:104913:112897:1 gene:ENSDNOG00000017080 transcript:ENSDNOT00000017080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIATSAQLARALYDNTAESPQELSFRRGDVLRVLQREGAGGLDGWCLCSLHGQQGIVPA
NRVTLLPAGPVPKPSLSQAPPAQPLPAHGNEDQEVYVVPPPARPCHTSGPLAGPYSPSPD
PIYKVPRDTLEIYDVPPTALRLPPSDPYDSPTSFSRPLARVAPHSPGEDEALYDVPLAPK
LPTELEPDLEWEGGREPGPPLYASPSNLKRTSALLNLYEAPEELLVDEEGRGADEGIYDV
PLLGPEVPPSPEPPGALASSGLDTMAHLLARSPPPPHRPRLPSTESLSRRPLPALPVPEA
PSPSPAPSPAPGRKGSIQDRPLPPPPPRLPGYGAPKAEGSPEGREVEGDPAGHHNEYEGI
PLAEEYDYVHLKGMDKAQGSRPPDKAFLEDPELLERELPRQQETLSPEEPLALPAGDLQL
LHFYAGQCQSHYSALQAAVAALMSSTQANQPPRLFVPHCKRVVVAAHRLVFVGDTLGRLA
ASAPLRAQVGAAGTALGQALRATVLAVKGAALGYPSSPAAQEMAQRVAELAGWALRFTTL
LTSLAP
Download sequence
Identical sequences XP_004474589.1.11602 ENSDNOP00000013237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]