SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000013481 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000013481
Domain Number 1 Region: 1-45
Classification Level Classification E-value
Superfamily EF-hand 0.0000000129
Family S100 proteins 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000013481   Gene: ENSDNOG00000017399   Transcript: ENSDNOT00000017399
Sequence length 46
Comment pep:novel scaffold:Dasnov3.0:JH578936.1:5686:5823:1 gene:ENSDNOG00000017399 transcript:ENSDNOT00000017399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSELEKAVVALIDVFHQYSGKEGDKHKLKKSELKELINNELSHFLE
Download sequence
Identical sequences ENSDNOP00000013481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]