SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000013556 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000013556
Domain Number 1 Region: 77-114
Classification Level Classification E-value
Superfamily SET domain 0.0000834
Family Viral histone H3 Lysine 27 Methyltransferase 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000013556   Gene: ENSDNOG00000017489   Transcript: ENSDNOT00000017487
Sequence length 126
Comment pep:novel scaffold:Dasnov3.0:JH562293.1:2016168:2016545:1 gene:ENSDNOG00000017489 transcript:ENSDNOT00000017487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISKNSCSYLFTGNECAYGSYPEIPLEEMPDADGIASTPSLHIQEPCSPATSSEALTPKEG
SPYKAPIYIPDDIPIPAEFELRESNMPGAGLGIWTKRRIEAGEKFGPYVGEQRSHLKDPS
YGWEVR
Download sequence
Identical sequences ENSDNOP00000013556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]