SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000013574 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000013574
Domain Number 1 Region: 523-736
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.94e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.0000512
Further Details:      
 
Domain Number 2 Region: 326-448
Classification Level Classification E-value
Superfamily PH domain-like 8.13e-19
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 3 Region: 17-90
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000866
Family SH3-domain 0.002
Further Details:      
 
Domain Number 4 Region: 205-243
Classification Level Classification E-value
Superfamily WW domain 0.0000101
Family WW domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000013574   Gene: ENSDNOG00000017510   Transcript: ENSDNOT00000017509
Sequence length 737
Comment pep:known_by_projection scaffold:Dasnov3.0:JH580497.1:414364:425941:1 gene:ENSDNOG00000017510 transcript:ENSDNOT00000017509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSGRWWPSTWGSLGPSRGSQLCALYAFTYTGEDGRQVNLAEGDRFLLLRKTNSDWWLAK
RLGAPSNSRPIFVPAAYVTEDSTPSRSQTTITPSQSLRTSGPKLFHSSLEELHLSKAAPG
RAQARTEQPPPLPPKITRSVSTASLSPLLRKPLQEGPSGRSLSQEDLLTEANANLAPPQP
LMSEPPVYCNLVDLRRCPRSPPPGPACPPLQRLDAWEQHLDPNSGRCFYVNSLTGCKSWK
PPRRTRSQETKPGSMEGIQTPSSGNGILQPQAKGSGSETGTAELLNLQGPSSLYRRRSSQ
PEPSDHPPASQAPRPPPQLLEDPHEVERSGLLNMTKIAQGGRKLRKSWGPSWVVLAGNSL
VFYREPPPTAPSSGWGPAGTRPESSVDLRGAALAHGRHLSSRRNVLHIRTVPGHEFLLQS
DDEAELRAWHGALRAVIERLDRENPLELRLSGSGPAELAELSAGEDDEEEPPLLPKSLLR
LSGRRSSSRSPEGTEQNRVRNKLKRLIAKRPSLQSLQERGLLRDQVFGCQLESLCQRDGD
TVPSFVQLCIAAVDKRGLDVDGIYRVSGNLAVVQKLRFLVDRERAVTSDGRYMFPEQPGQ
EGRLDLDSAEWDDIHVITGALKLFLRELPQPLVPTLLLPHFRAALALSESEQRLSQIQEL
IGSMPKPNHDTLRYLLEHLCRVIAHSDKNRMTPHNLGIVFGPTLFRPEQETSDLAAHALY
PGQLVQLMLTDFTNLFA
Download sequence
Identical sequences ENSDNOP00000013574 XP_004481364.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]