SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000013845 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000013845
Domain Number 1 Region: 147-277
Classification Level Classification E-value
Superfamily TNF-like 2.3e-39
Family TNF-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000013845   Gene: ENSDNOG00000017845   Transcript: ENSDNOT00000017844
Sequence length 277
Comment pep:known_by_projection scaffold:Dasnov3.0:JH561465.1:590838:594027:-1 gene:ENSDNOG00000017845 transcript:ENSDNOT00000017844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEPRANAAIAPKSEEDLLALAASRLSRRKRVAGAAVGVAMVLLLLVAIPLLVHSSRGPAH
YEMLGRCRMVCDPHGPRGPDPEGAPASVPPFPPGAKGETGRRGKAGLRGPPGPPGPRGPP
GEPGRPGPPGPPGPGPGGAAPPAGYMPRIAFYAGLRRPHEGYEVLRFDDVVTNVGNAYEA
ASGKFTCPMPGVYFFAYHVLMRGGDGTSMWADLMKNGQVRASAIAQDADQNYDYASNSVI
LHLDVGDEVFIKLDGGKVHGGNTNKYSTFSGFIIYPD
Download sequence
Identical sequences ENSDNOP00000013845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]