SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000014382 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000014382
Domain Number 1 Region: 110-206
Classification Level Classification E-value
Superfamily SET domain 0.0000536
Family Viral histone H3 Lysine 27 Methyltransferase 0.055
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000014382
Domain Number - Region: 706-1055,1105-1178
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0569
Family Hermes transposase-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000014382   Gene: ENSDNOG00000018526   Transcript: ENSDNOT00000018526
Sequence length 1238
Comment pep:known_by_projection scaffold:Dasnov3.0:JH570359.1:551722:596328:1 gene:ENSDNOG00000018526 transcript:ENSDNOT00000018526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DRMTENMKECLAQTKAAVGDMVTVVKTEVCSPLRDQEYGQPCKSFQQVDFWFCESCQEYF
VDECPNHGPPVFVSDTPVPVGIPDRAALTIPQGMEVVKEASGENDVRCINEVIPKGHIFG
PYEGQISTQDKSAGFFSWLIVDKNNRYKSIDGSDETKANWMRYVVISREEREQNLLAFQH
SERIYFRSCRDIRPGEQLRVWYSEDYMKRLHSVSQETIHRNLARGEKRLQREKSEQALDN
PEDLRGPIQLPVLRQGKSPYKRGFDEGDTHPQAKKKKIDLIFKDVLEASLESAKVEAHQL
ALSTSLVIRKVPKYQDDTYGQCAATGPHGVQSVSRAQGAGAWKRPQGTSKEPGPLEDEEE
EPSSFQADSPAEASLASDPRELPTTSFCPNCIRLKKKVRELQAELDMLKSGKLPEPPVLP
PQVLELPEFSDPAGKLFWMSLLSEGSTRRGQRGGWLKWSHLRGGLRRLPPLKGSLPSLTA
LVVGQTSPRFSASDLKRVKEGLSFFPPGVNASSLCFPASESMVSGPAIMEDDDQEVDSAD
ESVSNDMMTAADEPSKMSSAAGRRIRRFKQEWLKKFWFLRYSPTLNEMWCHVCRQYTVQS
SRTSAFIIGSKQFKIHTIKLHSQSNLHKKCLQLYKLRMHPEKTEEMCRNMTLLFNTAYHL
ALEGRPYLDFRPLAELLRKCELKVVDQYMNEGDCQILIHHIARALREDLVERVRQSPCLS
IILDGQSDDLLADTVAVYIQYTSSDGPPATEFLSLQELGFSSTESYLQALDRAFSALGIR
LQDERPTVGLGVDGANVTASLRASMFMTIRKTLPWLLCLPFMVHRPHLEILDAISGKELP
CLEELENNLKQLLSFYRYSPRLMCELRSTASTLCEETEFLGDIRAVRWIIGEQNVLNALI
KDYLEVVAHLKDVSSQTQRADASAIALALLQFLLDYQSIKLIYFLLDVIAVLSRLAYVFQ
GEYLLVSQVDDKIEEAIQEISRLADSPGEYLQEFEENFRESFNGIAMKNLRVAEAKFQSI
REKICQKTQVILAQRFDSRSRIFVKACQVFDLAAWPRSSEELMSYGKEDMVQIFDHLEAI
PTFSRDICREGLDPRGSLLMEWRELKADYYTKNGFKDLIGHICKYRQRFPLLNKIIQILK
VLPTSTACCEKGRNALQRVRKNHRSRLTLEQLSDLLTIAVNGPPIANFDAKRALDSWFEE
KSGNSYTLSAEVLSRMSVLEQKPVLQTVDHGSEFYPDI
Download sequence
Identical sequences ENSDNOP00000014382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]