SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000015329 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000015329
Domain Number 1 Region: 325-504
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.94e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.000000333
Further Details:      
 
Domain Number 2 Region: 5-219
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.13e-46
Family BAR domain 0.01
Further Details:      
 
Domain Number 3 Region: 192-297
Classification Level Classification E-value
Superfamily PH domain-like 2.47e-16
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 4 Region: 659-714
Classification Level Classification E-value
Superfamily SH3-domain 4.73e-16
Family SH3-domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000015329   Gene: ENSDNOG00000019769   Transcript: ENSDNOT00000019770
Sequence length 715
Comment pep:known_by_projection scaffold:Dasnov3.0:JH571364.1:1139842:1480065:1 gene:ENSDNOG00000019769 transcript:ENSDNOT00000019770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLQPLEFSECYLDSPWFRERIRAHEAELERTNKFIKELIKDGKNLIAATKSLSAAQRKF
AHSLRDFKFEFIGDAETDDERCIDASLREFSNFLKNLEEQREIMALSVTETLIKPLEKFR
KEQLGAVKEEKKKFDKETEKNYSLIDKHLNLSAKKKDSHLQETRNRFEGTRSEVEELMNK
IRQNPKDHKRASQFTAEGYLYVQEKRPAPFGSSWVKHYCMYRKAAKKFSMIPFEHRSGGK
LLGDGEVIFLKECTKRHTDSIDRRFCFDVEVIDRPGIPLTMQAFSEEERKQWLEALGGKE
TLFHSFSRAIPRPEGGAQLDQMGFTILRKCISAVETRGINDQGLYRVVGVSSKVQRLLSM
LMDVNTCNEVDLENSIDWDVKTITSALKQYLRSLPEPLMTYELHGDFIVPAKSGSPESRV
SAIHFLVHKLPEKNKEMLDILVKHLTNVANHSKQNLMTVANLGVVFGPTLMRPQEETVAA
IMDLKFQNIVVEILIENHEKLFRTLPDAILPESVSLSASPPNAPPRQSKKQGQRNKRPVA
VYNLCLDLEEGDGPDPPREDTPTSSLDSLSSPSPTTAAGHGPPGLDRNHLLADGCSFGDW
GSTAPSQTRASMVQWLNPQATTTPSSNPAATTPPSPKSSPFSLFPPATIAEKSPESSTSR
KARAVYPCEAEHSSELSFEIGAIFEDVQTSREPGWLEGTLNGKRGLIPQNYVKLL
Download sequence
Identical sequences ENSDNOP00000015329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]