SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000015477 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000015477
Domain Number 1 Region: 347-651
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-91
Family p120GAP domain-like 0.0000221
Further Details:      
 
Domain Number 2 Region: 218-339
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000566
Family PLC-like (P variant) 0.085
Further Details:      
 
Domain Number 3 Region: 166-215
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000143
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000015477
Domain Number - Region: 924-933
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000575
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000015477   Gene: ENSDNOG00000019949   Transcript: ENSDNOT00000019949
Sequence length 1147
Comment pep:known_by_projection scaffold:Dasnov3.0:JH579884.1:15729:133393:-1 gene:ENSDNOG00000019949 transcript:ENSDNOT00000019949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGGSARKSTGRPSYYYRLLRRPRLQRQRSRSRSRTRPARESPQERPGSRRSLPGSLSE
KSPSMEPSAATPFRVTGFLSRRLKGSIKRTKSQPKLDRNHSFRHILPGFRSAAAAAAASA
ADNERSHLMPRLKESRSHESLLSPSSAVEALDLSMEEEVVIKPVHSSILGQDYCFEVTTS
SGSKCFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELC
LDDVLYARTTGKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLVSL
PAASVAGRQFVEKWYPVVTPNPKGGKGPGPMIRIKARYQTITILPMEMYKEFAEHITNHY
LGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENT
LATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSASDLPEHQGNLKMCCE
LAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLF
NLLQEYPDDRTARTLTLIAKVTQNLANFAKFGSKEEYMSFMNQFLEHEWTNMQRFLLEIS
NPETISNTAGFEGYIDLGRELSSLHSLLWEAVSQLEQSIVSKLGPLPRILRDVHTALSTP
ASGQLVGTNDLASTPGSGSSSISAGLQKMVIENDLSGLIDFTRLPSPTPENKDLFFVTRS
SGVQPSPARSSSYSEANEPDLQMANGGKSLSMVDLQDARTLDGEAGSPAGPDALPADGQV
PTTQLVAGWPARVAPVNLAGLATVRRAGQTPTTPGSSEGAPGRPQLLAPLSFQNPVYQMA
AGLPLSPRGLGDSGSEGHSSLSSHSNSEELAAAAKLGSFSTTAEELARRPGELARRQMSL
TEKGGQPTVPRQNSAGPQRRIDQPPPPPPPPPPAPRGRTPPTLLSTLQYPRPSSGTLASA
SPDWAGPGTRLRQQSSSSKGDSPELKPRAVHKQGPSPVSPNALDRTAAWLLTMNAQLLED
EGLGPDPPHRDRLRSKEEPSQAEKDLAVLQDKLRISTKKLEEYETLFKCQEETTQKLVLE
YQARLEEGEERLRRQQEDKDIQMKGIISRLMSVEEELKKDHAEMQAAVDSKQKIIDAQVG
AAHILAH
Download sequence
Identical sequences ENSDNOP00000015477 XP_004480708.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]