SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000016197 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000016197
Domain Number 1 Region: 102-234
Classification Level Classification E-value
Superfamily TNF-like 3.11e-37
Family TNF-like 0.0000966
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000016197   Gene: ENSDNOG00000024729   Transcript: ENSDNOT00000024019
Sequence length 243
Comment pep:known_by_projection scaffold:Dasnov3.0:JH566902.1:123450:124432:1 gene:ENSDNOG00000024729 transcript:ENSDNOT00000024019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLLALLLLGLAAGSAPLDDNKIPSLCPGHPGLPGTPGHHGSQGLPGRDGRDGRDGAPG
APGERGEGGRPGLPGPRGEPGPRGEVGPAGATGPAGECSVPPRSAFSAKRSESRVPPPSD
APLPFDRVLVNEQGHYDAATGKFTCQVPGVYYFAVHATVYRASLQFDLVKNGESIASFFQ
FFGGWPKPASLSGGAMVRLEPEDQVWVQVGVGDYIGIYASIKTDSTFSGFLVYSDWHSSP
VFA
Download sequence
Identical sequences ENSDNOP00000016197 XP_004456317.1.11602 9361.ENSDNOP00000016197 ENSDNOP00000016197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]