SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000016432 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000016432
Domain Number 1 Region: 51-179
Classification Level Classification E-value
Superfamily TNF-like 4.14e-33
Family TNF-like 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000016432   Gene: ENSDNOG00000024087   Transcript: ENSDNOT00000025078
Sequence length 181
Comment pep:novel scaffold:Dasnov3.0:JH562137.1:65296:96128:-1 gene:ENSDNOG00000024087 transcript:ENSDNOT00000025078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLA
THFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHN
GNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFET
K
Download sequence
Identical sequences ENSDNOP00000016432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]