SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000016606 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000016606
Domain Number 1 Region: 2-220
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.59e-48
Family IMD domain 0.0000989
Further Details:      
 
Domain Number 2 Region: 332-409
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000446
Family SH3-domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000016606   Gene: ENSDNOG00000024549   Transcript: ENSDNOT00000024679
Sequence length 528
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569526.1:2531688:2566643:-1 gene:ENSDNOG00000024549 transcript:ENSDNOT00000024679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPEMDQVYRSTIAIYKSILEQFNPALENLVYLGNNYLRAFHAQSRPSGSSWRENGGRGR
LPPLSHRPPPPGEILVQMSDTQRHLNSDLEVVVQTLHGDLLQHMEKNTKLDMQFIKDSRQ
HYEIEYRHRAANLEKCMSELWRMERKRDKNAREMKESVNRLHAQMQAFVSESQRAAELEE
KRRYRFLAEKHLLLSNTFLQFFGRARGTLQNRVLLWKEQSEASRGSARAHSPGLLGPSLG
PPYPSGRLTPTRLDMVRPWAPPPPFAPPPPXRRAHPRAAAAQGARADPREACPPMCRCTP
RPPPAASLYTSSTQRSRANSSSEYPGGGGGGSRKVRALVSHSEGANHTLLRFSAGDVVEV
LVPEAQNGWLYGRLEGSSASGWFPEAYVKPLEEVPLNPVTSMTPMTPKNELPSRSYPLRG
SHSLDDLLDRPGSNTAPSEYWDGQSRSRTPSRVPSRAPSPAPTPLPGSRRSSMGSMGVAS
DVKKLMAWEQQPPELFPRLPHPTRGTNPFATVKLRPTITNDRSAPLIR
Download sequence
Identical sequences ENSDNOP00000016606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]