SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000017442 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000017442
Domain Number 1 Region: 540-689
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-66
Family Ankyrin repeat 0.00000175
Further Details:      
 
Domain Number 2 Region: 33-270,302-327
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.13e-64
Family BAR domain 0.0016
Further Details:      
 
Domain Number 3 Region: 418-535
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.49e-39
Family Pyk2-associated protein beta ARF-GAP domain 0.0000047
Further Details:      
 
Domain Number 4 Region: 293-410
Classification Level Classification E-value
Superfamily PH domain-like 4.72e-20
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 
Domain Number 5 Region: 1035-1109
Classification Level Classification E-value
Superfamily SH3-domain 6.3e-16
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000017442   Gene: ENSDNOG00000025715   Transcript: ENSDNOT00000024340
Sequence length 1111
Comment pep:known_by_projection scaffold:Dasnov3.0:JH564091.1:378914:741838:1 gene:ENSDNOG00000025715 transcript:ENSDNOT00000024340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDQISVSEFIAETTEDYNSPTTSSFTTRLHNCRNTVTLLEEALDQDRTALQKVKKSVKA
IYNSGQDHIQNEENYAQVLDKFGSNFLSRDNPDLGTAFVKFSALTKELSTLLKNLLQGLS
HNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKIEKEKREHAKQHGMIRTEITG
AEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNLIKYYHAQCNFFQDGLKTADK
LKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLDQKEDSQSRQGGYSMHQLQGN
KEYGSEKKGYLLKKSDGLRKVWQRRKCAVKNGILTISHATSNRQPAKLNLLTCQVKPNAE
DKKSFDLISHNRTYHFQAEDEQDYVAWISVLTNSKEEALTMAFRGEQSTGENSLEDLTKA
IIEDVQRLPGNDVCCDCGSTEPTWLSTNLGILTCIECSGIHREMGVHISRIQSLELDKLG
TSELLLAKNVGNNSFNEIMEANLPSPSPKPTPSSDMTARKEYITAKYVDHRFSRKTCSSS
SAKLNELLEAIRSRDLLALIQVYAEGVELMEPLLEPGQELGETALHLAVRTADQTSLHLV
DFLVQNCGNLDKQTALGNTVLHYCSMYGKPECLKLLLRSKPTVDIANQAGETALDIAKRL
KATQCEDLLSQAKSGKFNPHVHVEYEWNLRQEEMDESDDDLDDKPSPIKKERSPRPQSFC
HSSSISPQDKLALPGFSTSRDKQRLSYGPFTNQIFVSTSTDSPTSPTAEAPPLPPRNAGK
GPSGPPSTLPLSTQTSSGSSTLSKKRPPPPPPGHKRTLSDPPSPLPHGPPHKGAVPWGND
VGPSSSSKTTNKFEGLSQQSSTSSAKTALGPRLPKLPQKVALRKTEISHHLSLDKANIPP
EIFQKSSQLAEFPQKPPPGDLPPKPTELAPKPQIGDLPPKPGELPPKPQLGDLPPKPQLS
DLPPKPQAKDLPPKPQLGDLLSKSQPGDVSPKAQQPPELTQKSHPVDLSPNVHSRDASQK
QSSEDSSDLTPTLPETPVPLPRKINTGKSKVRRVKTIYDCQADNDDELTFIEGEVIVVTG
EEDQEWWIGHIEGQPERKGVFPVSFVHILSD
Download sequence
Identical sequences ENSDNOP00000017442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]