SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000017747 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000017747
Domain Number 1 Region: 138-199
Classification Level Classification E-value
Superfamily TNF-like 2.49e-16
Family TNF-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000017747   Gene: ENSDNOG00000042888   Transcript: ENSDNOT00000041028
Sequence length 200
Comment pep:novel scaffold:Dasnov3.0:JH569934.1:90494:92039:-1 gene:ENSDNOG00000042888 transcript:ENSDNOT00000041028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTESMIRDVELAEEALPKKVGPQGSRRCWCLSLFSFLLVAGATALFCLLQFGVIGPQRD
EQLPSGFHLNSPLAQTLSECPRTPDSGFGPGRRPWGGGRGGPFQRGQRRGSVWGRLLGGL
RVSPSSPPSSGSSSRAPSDKPVAHVVADPEAEGRLRWLSRRANTLLANGAALTDNQLVVP
ADGLYLVYSQLLFTGQGCAP
Download sequence
Identical sequences ENSDNOP00000017747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]