SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000017870 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000017870
Domain Number 1 Region: 21-302
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.41e-69
Family FCH domain 0.0057
Further Details:      
 
Domain Number 2 Region: 359-422
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-18
Family SH3-domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000017870   Gene: ENSDNOG00000030783   Transcript: ENSDNOT00000033125
Sequence length 424
Comment pep:known_by_projection scaffold:Dasnov3.0:JH567781.1:1330867:1338871:-1 gene:ENSDNOG00000030783 transcript:ENSDNOT00000033125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPEEDAGGEALGGSFWEAGNYRRTVQRVEDGHRLCGDLVSCFQERARIEKAYAQQLADW
ARKWRGAVEKGPQYGTLEKAWHAFFTAAERLSALHLEVREKLQGQDSDRVRAWQRGAFHR
PVLGGFRESRAAEDGFRKAQKPWLKRLKEVEASKKSYHATRKDEKTAQTRESHAKADSAV
SQEQLRKLQERVERCTKEAEKTKTQYEQTLAELHRYTPRYMEDMEQAFEACQAAERQRLL
FFKDTLLTLHQHLDLSSSEKFQELHRDLHQSIEAASDQEDLRWWRSTHGPGMAMNWPQFE
EWSLDTQRTISRKEKGGRSPNEVTLTSIVPTRDGAAPQPQSLSSPGSGQDEEWSDEESSR
KATTGVRVRALYDYAGQEADELSFQAGEELLKMSEEDEQGWCQGQLQSGRIGLYPANYVE
CVGA
Download sequence
Identical sequences XP_004457990.1.11602 XP_012380359.1.11602 ENSDNOP00000017870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]