SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000017963 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000017963
Domain Number 1 Region: 5-242
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.23e-83
Family IMD domain 0.000000539
Further Details:      
 
Domain Number 2 Region: 332-397
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000433
Family SH3-domain 0.0000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000017963   Gene: ENSDNOG00000039104   Transcript: ENSDNOT00000043956
Sequence length 506
Comment pep:known_by_projection scaffold:Dasnov3.0:JH568234.1:1272324:1328779:-1 gene:ENSDNOG00000039104 transcript:ENSDNOT00000043956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TQANHYLHNSIQNVMEQFNPGLRNLINLGKNYEKAVNAMILAGKAYYDGVAKIGEIATGS
PVSTELGHVLIEMSSTHKKLNDSLDENFKKFHKEIIHELEKKTELDVKYMNATLKRYQTE
HRNKLNSLEKSQAELKKIRRKGQGGRNALKYEHKEIEFVETITSHQSEIQKFIADGCKEA
LLEEKRRFCFLVDKHCSFANYIHYYHLQSAELLSSKLPRWQETCGDATKVPEKIMNMIEE
IKTPISTPISGTPQPSPMIERSSMVGKDDTLSKYSPKMPPAPSTKAYTSPLIDMFNNPAT
VTQDSERINNLTADASDDSSLQRSVSVATGLNMMKKQKVKTIFPHTAGTNKTLLSFTQGE
IITLLIPEEKDGWLYGEHDDTKKRGWFPSSYTKLLEENEMETETVATPSPAPVRSISTVN
LSEKSSVVIPPPDYLECLSTGAAADKKGDISKSASTFKAPVSKPEITSPSDADGTAKPPF
LSGENPFATVKLRPTVTNDRSALIIK
Download sequence
Identical sequences ENSDNOP00000017963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]