SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000018168 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000018168
Domain Number 1 Region: 155-353
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.22e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.00017
Further Details:      
 
Domain Number 2 Region: 38-151
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-30
Family Pleckstrin-homology domain (PH domain) 0.0000058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000018168   Gene: ENSDNOG00000049368   Transcript: ENSDNOT00000032655
Sequence length 645
Comment pep:known_by_projection scaffold:Dasnov3.0:JH562852.1:2598716:2663871:1 gene:ENSDNOG00000049368 transcript:ENSDNOT00000032655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPPSLPALLHILQSACLFLSIARSRSVMTGELMAAFHPSSTPNPLERPIKMGWLKKQRSI
VKNWQQRYFVLRAQQLFYYKDEEDVKPQGCMYLPGSTIKEIATNPEEAGKFVFEVIPASW
DQNRMGQDAYVLMASSQAEMEEWVKFLRRVAGTPSGAVFGQRLDETVAYEQKFGPHLVPI
LVEKCAEFIRDHGLHEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRDTDVHTVASVKLYL
RDLPEPVVPWSQYEGFLCGQLMNADETKAQQELVKQLSLLPRDNYSLLSYICRFLHEIQL
NCAVNKMSVDNLATVIGVNLIRSKVEDPAVIMRGTPQIQRVMTMMIRDHEILFPKSKDAP
LSPPAQKNDPKKPPVARSSVGWEATEESSISRTDSFSNSTSDSDTTSPTGSQPSDGYLEE
SSKFPRENLGDWKLQSRKRTQTLPNRKCFLTSAFQGTNSSQVEIFKNEFWSPSSVAKAGE
GHRRTLSQDVRHFSDSQRTSAYDNVPLSPRSPGGEAGAPSSQVCDSKGDTPSSPNSEAGP
EKKDPGEQELESLQRVVQELRKELETQKQMYEEQIKSLEKENYDVWAKVVRLNEELEKEK
KKFAALEISLRNVERSREDVERRNKVLEEEVKEFVKLMKEPKTDA
Download sequence
Identical sequences ENSDNOP00000018168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]