SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000018331 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000018331
Domain Number 1 Region: 235-304
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.01e-18
Family SAM (sterile alpha motif) domain 0.0000856
Further Details:      
 
Domain Number 2 Region: 158-225
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000144
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000018331   Gene: ENSDNOG00000038370   Transcript: ENSDNOT00000046291
Sequence length 373
Comment pep:known_by_projection scaffold:Dasnov3.0:JH568778.1:6134460:6187658:1 gene:ENSDNOG00000038370 transcript:ENSDNOT00000046291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKRKPSNASEKEKHQKPKRSSSFGNFDRFRNNSISKPDDSTEVYEGEPINESGEQNKTS
NNGGGLGKKMRAISWTMKKKMGKKYIKALSEDKEEEDGEDALSYRNSDPVIGTLTEKVSL
KASDSMDSLYSGQSSSSGITSCSDGTSNRDSFRLDDEGPYAGPFCGRARVHTDFTPSPYD
TDSLKIKKGDIIDIICKTPMGMWTGMLNNKVGNFKFIYVDVISEEDAIPKKIKAHRRSKR
EKPKTLKEFLERIHLQEYTSTLLLNGYETLEDLKDIKEGHLIELNIENPEDRKRLLSAAE
NLLDEETIQEQENESAPLSLSPDISLNKSQLEDCPRDSGCYISSENSDNGKEDLESENLP
DMVQKITITEPTD
Download sequence
Identical sequences XP_004462702.1.11602 ENSDNOP00000018331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]