SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000018618 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000018618
Domain Number 1 Region: 17-121
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.03e-21
Family FCH domain 0.016
Further Details:      
 
Domain Number 2 Region: 219-303
Classification Level Classification E-value
Superfamily SH3-domain 1.21e-20
Family SH3-domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000018618   Gene: ENSDNOG00000044349   Transcript: ENSDNOT00000034791
Sequence length 304
Comment pep:known_by_projection scaffold:Dasnov3.0:JH570833.1:150132:318159:-1 gene:ENSDNOG00000044349 transcript:ENSDNOT00000034791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVNYDDSIGVEVSSDSFWETKEKYEKSLKELDQSTPQYMENMEQVFEQCQQFEEKRLRF
FREVLLEVQKHLDLSNLASYKNIYHDLEQSIKAADAVEDLRWFRANHGPGMSMNWPQFEE
WSADLNRTLSRREKKKAADGVTLMGINQTGDQSLQNKHSSSSLSVPSNPAQSAQSQSSYN
PFEDEDDTGSTVSEKEDIKAKNVSSYEKTQSYPTDWSDDESNNPFSSTDANGDSNPFEED
TTSGTEVRVRALYDYEGQEHDELSFKAGDELTKIEDEDEQGWCKGRLDDGQVGLYPANYV
EAIQ
Download sequence
Identical sequences ENSDNOP00000018618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]