SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000018693 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000018693
Domain Number 1 Region: 53-162
Classification Level Classification E-value
Superfamily Immunoglobulin 1.97e-17
Family V set domains (antibody variable domain-like) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000018693   Gene: ENSDNOG00000041248   Transcript: ENSDNOT00000034592
Sequence length 239
Comment pep:novel scaffold:Dasnov3.0:JH569425.1:144394:149902:1 gene:ENSDNOG00000041248 transcript:ENSDNOT00000034592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTQTLLRRLEPVADWGLGCRGDVCAGEMAPWEGAAGLPAALFLLHVPGCLALWGPSAVT
GTVGGSLSVQCHYEEKFKAHNKYWCRRPFIPPCDKIVETKVSESEVRRGRVSMRDHPANL
TFTVTVENLTEDDGGQYRCGVVTSLFGGPDPVVEILVIVSPASIATSNPRSPSGTPDFPT
SVPAPNGPRTTEEEPPATSPYPRSLLSSVHFLLLVFLEVPLLLGMLSAVLWVNRPQRGS
Download sequence
Identical sequences XP_004465590.1.11602 XP_004465591.1.11602 ENSDNOP00000018693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]