SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000018818 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000018818
Domain Number 1 Region: 12-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.78e-81
Family BAR domain 0.0000000174
Further Details:      
 
Domain Number 2 Region: 301-365
Classification Level Classification E-value
Superfamily SH3-domain 7.88e-23
Family SH3-domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000018818   Gene: ENSDNOG00000038013   Transcript: ENSDNOT00000032819
Sequence length 368
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569150.1:15344:41809:-1 gene:ENSDNOG00000038013 transcript:ENSDNOT00000032819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVAEVLARTIEYLQP
NPASRAKLTMLNTVSKIRGQVKSPGYPQPEGLLGECMTRHGRELGGESNFGDALLDAGES
MKRLAEVKDSLDIEVKQNFIDPLQNLCDKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPD
DELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELADKL
KRRMREASSRPKREYKPKPREPFDLGEPEQPNGGFPCATAPKITASSSFRSSEKPIRTPS
RSMPPLDQPSCKALYDFEPENDGELGFREGDIITLTNQIDENWYEGMLSGQSGFFPLSYV
EVLVPLPQ
Download sequence
Identical sequences ENSDNOP00000018818 XP_004464262.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]