SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000019176 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000019176
Domain Number 1 Region: 187-295
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-28
Family SH2 domain 0.0000215
Further Details:      
 
Domain Number 2 Region: 1-31
Classification Level Classification E-value
Superfamily PH domain-like 0.000000211
Family Phosphotyrosine-binding domain (PTB) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000019176   Gene: ENSDNOG00000040237   Transcript: ENSDNOT00000040476
Sequence length 308
Comment pep:known_by_projection scaffold:Dasnov3.0:JH582987.1:18918:29265:-1 gene:ENSDNOG00000040237 transcript:ENSDNOT00000040476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACHILECCEGLAQSVISTVGQAFELRFKQSLHSPPKVAVPPERLTGPEDSAWGDEEEAEH
AYYNSIPGKEPPPGGLVDSRLALGQPCAQAALFQGPPTGSRRFRARHAPRGLGQARAAPP
GDGYVQAEPRGPHDYEEHLYVNTQGLDVPEPEDSPKKDLFDMRPFEDALKLHECSVAAAA
ECALLPLEDRWPSPPTRRAPVAPTEEQLRQEPWYHGRMSRRAAERLLRADGDFLVRDSTT
NPGQYVLTGMHAGQPKHLLLVDPEGVVRTKDVLFESIGHLIEHHLRSGQPIVAAESELHL
RGVVLREP
Download sequence
Identical sequences ENSDNOP00000019176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]