SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000019426 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000019426
Domain Number 1 Region: 711-1033
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.57e-90
Family p120GAP domain-like 0.0000000000158
Further Details:      
 
Domain Number 2 Region: 337-444
Classification Level Classification E-value
Superfamily SH2 domain 4.71e-27
Family SH2 domain 0.00069
Further Details:      
 
Domain Number 3 Region: 156-257
Classification Level Classification E-value
Superfamily SH2 domain 3.23e-25
Family SH2 domain 0.00053
Further Details:      
 
Domain Number 4 Region: 462-569
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-24
Family Pleckstrin-homology domain (PH domain) 0.0066
Further Details:      
 
Domain Number 5 Region: 589-722
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.47e-16
Family Synaptotagmin-like (S variant) 0.033
Further Details:      
 
Domain Number 6 Region: 265-338
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000525
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000019426   Gene: ENSDNOG00000036632   Transcript: ENSDNOT00000051385
Sequence length 1040
Comment pep:known_by_projection scaffold:Dasnov3.0:JH570378.1:1991226:2096877:1 gene:ENSDNOG00000036632 transcript:ENSDNOT00000051385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAAEAGSEEGGPVTAGAGGGGVVAGSSDYPAVCRVKIPAALPAAATPYPGLVETGIAGT
LGVGAASGSGFLGVGSVAGVLGATGLTGGGAVAGVAGAAAGPVGDMAFTKGTISLPAETF
GGGGFPPLPPPPQLPPLGAGLGTVDEGDSLDGPEYEEEEVAIPLTAPPTNQWYHGKLDRT
IAEERLRQAGKPGSYLIRESDRRPGSFVLSFLSQTNVVNHFRNRIIAMCGDYYIGGRRFS
SLSDLIGYYSHVSCLLKGEKLLYPVAPPEPVEDRRRVRAILPYTKVPDTDEISFLKGDMF
IVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGREEDPHEGKIWFHGKISKQEAYNLLMT
VGQVCSFLVRPSDNTPGDYSLYFRTSENIQRFKICPTPNNQFMMGGRYYNSIGDIIDHYR
KEQIVEGYYLKEPVPMQDQEQVLSDTVDGKEIYNTIRRKTKDAFYKNIVKKGYLLKKGKG
KRWKNLYFILEGSDAQLIYFESEKRATKPKGLIDLSVCSVYVVHDSLFGRPNCFQIVVQH
FSEEHYIFYFAGETPEQAEDWMKGLQAFCNLRKSSPGTSNKRLRQVSSLVLHIEEAHKLP
VKHFTNPYCNIYLNSVQVAKTHAREGQNPVWSEEFVFDDLPPDINRFEITLSNKTKKSKD
PDILFMRCQLSRLQKGHATDEWFLLSSHIPLKGIEPGSLRVRARYSMEKIMPEEEYSEFK
ELILLKELHVVNALSHVCGQDRTLLASILLRIFLHEKLESSLLCTLNDREISMEDEATTL
FRATTLASTLMEQYMKATATQFVHHALKDSILKIMESKQSCELSPSKLEKNEDVNTNLAH
LLNILSELVEKIFMASEILPPTLRYIYGCLQKSVQDKWPTNTTMRTRVVSGFVFLRLICP
AILNPRMFNIISDSPSPIAARTLILVAKSVQNLANLVEFGAKEPYMEGVNPFIKSNKHRM
IMFLDELGNVPELPDTTEHSRTDLSRDLAALHEMCVAHSDELRTLSNERGAQQHVLKKLL
AITELLQQKQNQYTKTNDVR
Download sequence
Identical sequences ENSDNOP00000019426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]