SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000020176 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000020176
Domain Number 1 Region: 16-242
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.72e-57
Family BAR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 253-448
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.69e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000020176   Gene: ENSDNOG00000004227   Transcript: ENSDNOT00000034985
Sequence length 813
Comment pep:known_by_projection scaffold:Dasnov3.0:JH582403.1:482927:576128:-1 gene:ENSDNOG00000004227 transcript:ENSDNOT00000034985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRDSASSFLTDMFLNFLFRAEKTEVLSDDLLQVEKRLELVKQVSHSTHKKLTTCLQGQQG
AEADKRSKKLPLTTLAQCLMEGSAILGDDTLLGKMLKLCGETEDKLAQELIHFELQVERD
VIEPLFLLAEVEIPNIQKQRKHLAKLVLDMDSSRTRWQQTSKSSGLSSNLQPAGAKADAL
REEMEEAANRVEICRDQLSADMYSFVAKEIDYANYFQMLIEVQAEYHRKALALLQAVLPQ
IKAQQEAWVEKPSFGKPLEEHLTISGREIAFPIEACVTMLLECGMQEEGLFRVAPSASKL
KKLKAALDCCVVDVQEYSADPHAIAGAGALKSYLRELPEPLLTFELYDEWIQASNIQEQD
KRLQALWNACEKLPKANHNNIRYLIKFLSRLSEYQDINKMTPSNMAIVLGPNLLWPQAEG
NITEMMTTVSLQIVGIIEPIIQHADWFFPGEIEFNITGNYGSPVHVNHNANYSSMPSPDM
DPADRRQPEQARRPLSVATDNMMLEFYKKDGLRKIQSMGVRVMDTSWVARRGSSVGRKAS
CAPPSTQPPAPPAELAPPHSPVPEQPLEGAAAPVLSPCGLGLQPGPERTSTSKSKELSPG
SGQKGSPGSSQGTPCAGTQPGAQAGATPSQPPTDQSPLTVRKVSKKLAPIPPKVPFGQPG
ALEQSMGQPSPVSLSPTPPSTPSPYGLNCPQGYPPASGQLSPAAAPPLSSPSAFTSTLSK
ARPTPKPRQRPTLPPPQPPTVSLSASSPQSTEHPVLDGMSPGESMSTDLVHFDIPSIHVE
LGSTLRLSPLEHARRHSVTEKRDSEEESESTAL
Download sequence
Identical sequences ENSDNOP00000020176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]