SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000020468 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000020468
Domain Number 1 Region: 413-688
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000677
Family Rhodopsin-like 0.04
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000020468
Domain Number - Region: 34-93
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00034
Family Hormone receptor domain 0.0028
Further Details:      
 
Domain Number - Region: 131-198
Classification Level Classification E-value
Superfamily STAT 0.051
Family STAT 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000020468   Gene: ENSDNOG00000013629   Transcript: ENSDNOT00000037955
Sequence length 757
Comment pep:known_by_projection scaffold:Dasnov3.0:JH564821.1:152747:192835:1 gene:ENSDNOG00000013629 transcript:ENSDNOT00000037955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTTVAGSQEGNKGTKPPPAVSTTKIPPVTNIFPLPERFCEALEARGIWWPQTQRGMMVE
RPCPKGTRGTASYLCVVSTGTWNPKGPDLSNCTSHWVNQLAQKIRSGENAASLANELAKH
TKGPVFAGDVSSSVRLMEQLVDILDAQLQELKPSEKDSAGRSYNKLQKREKTCRAYLKAI
VDTVDNLLRPEALESWKHMNSSEQAHTATMLLDTLEEGAFVLADNLLEPTRVSMPTDNIV
LEVAVLSTEGQVQDFKFPLGIKGSGSSIQLSANTVKQNSRNGLAKLVFIIYRSLGQFLST
ENATIKLGGDFIGRNSTIAVNSHVISVSINKESSRVYLTDPVLFTLPHIDPDNYFNANCS
FWNYSERTMMGYWSTQGCKLVDTNKTRTTCACSHLTNFAILMAHREIAYKDGVHELLLTV
ITWVGIVISLVCLAICIFTFCFFRGLQSDRNTIHKNLCINLFIAEFIFLIGIDKTKYMIA
CPIFAGLLHFFFLAAFAWMCLEGVQLYLMLVEVFESEYSRKKYYYVAGYLFPATVVGVSA
AIDYKSYGTEKACWLHVDNYFIWSFIGPVTFIILLNIIFLVITLCKMVKHSNTLKPDSSR
LENIKSWVLGAFALLCLLGLTWSFGLLFINEETIVMAYLFTIFNAFQGVFIFIFHCALQK
KVRKEYGKCFRHSYCCGGLPTESPHSSVKASTTRTSARYSSGTQSRIRRMWNDTVRKQSE
SSFISGDINSTSTLNQGLTSHGPRAHLQDLYHLEDIH
Download sequence
Identical sequences ENSDNOP00000020468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]