SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000021149 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000021149
Domain Number 1 Region: 84-252
Classification Level Classification E-value
Superfamily TNF-like 5.13e-56
Family TNF-like 0.000000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000021149   Gene: ENSDNOG00000034085   Transcript: ENSDNOT00000052510
Sequence length 253
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569086.1:918763:929021:-1 gene:ENSDNOG00000034085 transcript:ENSDNOT00000052510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYSFPTQLQDKYSRSGIACFLKEDDSSWDPTEEESMDSPCWRIKWQLHQFIRKMILRTL
EETIPTVQEKQQHSSHLGRERGPQRVAAHITGSSQRRSTFPAAGSKNEKALGQKINSWES
SRKGHSFLSNLHLRNGELVIHQTGFYYIYSQTYFRFQESEETLGAVLTEQNKKKTKQMVQ
YIYKWTSYPDPILLMKSARNSCWSKDSEYGLYSLYQGGVFELKENDRIFVSVTNEQLIDM
DQQASFFGAFLIG
Download sequence
Identical sequences ENSDNOP00000021149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]