SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000021163 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000021163
Domain Number 1 Region: 17-127
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.83e-28
Family Hormone receptor domain 0.0000698
Further Details:      
 
Domain Number 2 Region: 90-386
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000915
Family Rhodopsin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000021163   Gene: ENSDNOG00000039246   Transcript: ENSDNOT00000047255
Sequence length 415
Comment pep:known_by_projection scaffold:Dasnov3.0:JH579845.1:494534:522877:1 gene:ENSDNOG00000039246 transcript:ENSDNOT00000047255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTRLTAPLCPQALLLLGLNPASASPQDQHCESLSLASNVSGLQCNASVDLIGTCWPRSPA
GQLVARPCPAYFYGVRYNTTNNGYRECLANGSWAARVNYSQCQEILNEEKKSKVHYRVAV
IINYLGHCVSLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTMSPEV
HQSNVAWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFICIGWGVPF
PIIVAWAIGKLYYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA
STTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEASRVVFIYFNSFLESFQGFFVS
VFYCFLNSEVRSAIRKRWHRWQDKHSIRARVARAMSIPTSPTRVSFHSIKQSTAV
Download sequence
Identical sequences ENSDNOP00000021163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]