SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000021478 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000021478
Domain Number 1 Region: 22-116
Classification Level Classification E-value
Superfamily Immunoglobulin 1.99e-23
Family V set domains (antibody variable domain-like) 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000021478   Gene: ENSDNOG00000045253   Transcript: ENSDNOT00000037653
Sequence length 138
Comment pep:novel scaffold:Dasnov3.0:JH575930.1:1443:1856:1 gene:ENSDNOG00000045253 transcript:ENSDNOT00000037653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHWEPGPELTFFSFSGSWAQSTLTQPFSQSRAPGQMVTLFCAGSSSDIIFGYVSWYEQHP
GKIPKLCIYEVSKGPSVIPGHLSVSRSGNMASLSISRLKPKDEADDHCMVYMSSRTFHSA
PSSRASETKTHPEPSLLI
Download sequence
Identical sequences ENSDNOP00000021478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]